PTK2B Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16045T
Artikelname: PTK2B Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16045T
Hersteller Artikelnummer: CNA16045T
Alternativnummer: MBL-CNA16045T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 780-1009 of human PTK2B (NP_004094.3).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 116kDa
NCBI: 2185
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: REEDFIQPSSREEAQQLWEAEKVKMRQILDKQQKQMVEDYQWLRQEEKSLDPMVYMNDKSPLTPEKEVGYLEFTGPPQKPPRLGAQSIQPTANLDRTDDLVYLNVMELVRAVLELKNELCQLPPEGYVVVVKNVGLTLRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLAQQNAVTSLSEECKRQMLTASHTLAVDAKNLLDAVDQAKVLANLAHPPAE
Target-Kategorie: PTK2B
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200