IGHMBP2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16053T
Artikelname: IGHMBP2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16053T
Hersteller Artikelnummer: CNA16053T
Alternativnummer: MBL-CNA16053T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 540-720 of human IGHMBP2 (NP_002171.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 109kDa
NCBI: 3508
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: PYNLQVDLLRQSLVHRHPELEIKSVDGFQGREKEAVILSFVRSNRKGEVGFLAEDRRINVAVTRARRHVAVICDSRTVNNHAFLKTLVEYFTQHGEVRTAFEYLDDIVPENYSHENSQGSSHAATKPQGPATSTRTGSQRQEGGQEAAAPARQGRKKPAGKSLASEAPSQPSLNGGSPEGV
Target-Kategorie: IGHMBP2
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:100