TRIM27 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16065T
Artikelname: TRIM27 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16065T
Hersteller Artikelnummer: CNA16065T
Alternativnummer: MBL-CNA16065T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human TRIM27 (NP_006501.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 58kDa
NCBI: 5987
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MASGSVAECLQQETTCPVCLQYFAEPMMLDCGHNICCACLARCWGTAETNVSCPQCRETFPQRHMRPNRHLANVTQLVKQLRTERPSGPGGEMGVCEKHREPLKLYCEEDQMPICVVCDRSREHRGHSVLPLEEAVEGFKEQIQNQLDHLKRVKDLKKRRRAQGEQARAELLSLTQMEREKIVWEFEQLYHSLKEHEYRL
Target-Kategorie: TRIM27
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200