SLC18A3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16068T
Artikelname: SLC18A3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16068T
Hersteller Artikelnummer: CNA16068T
Alternativnummer: MBL-CNA16068T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 473-533 of human SLC18A3 (NP_003046.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 57kDa
NCBI: 6572
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: GLLTRSRSERDVLLDEPPQGLYDAVRLRERPVSGQDGEPRSPPGPFDACEDDYNYYYTRS
Target-Kategorie: SLC18A3
Application Verdünnung: WB: IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200