MLF2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16076T
Artikelname: MLF2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16076T
Hersteller Artikelnummer: CNA16076T
Alternativnummer: MBL-CNA16076T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-65 of human MLF2 (NP_005430.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 28kDa
NCBI: 8079
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MFRFMRDVEPEDPMFLMDPFAIHRQHMSRMLSGGFGYSPFLSITDGNMPGTRPASRRMQQAGAVS
Target-Kategorie: MLF2
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:100 - 1:200