PROZ Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16082T
Artikelname: PROZ Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16082T
Hersteller Artikelnummer: CNA16082T
Alternativnummer: MBL-CNA16082T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 220-340 of human PROZ (NP_003882.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 45kDa
NCBI: 8858
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: SLLHRNITVKTYFNRTSQDPLMIKITHVHVHMRYDADAGENDLSLLELEWPIQCPGAGLPVCTPEKDFAEHLLIPRTRGLLSGWARNGTDLGNSLTTRPVTLVEGEECGQVLNVTVTTRTY
Target-Kategorie: PROZ
Application Verdünnung: WB: WB,1:500 - 1:2000