MTA1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
MBL-CNA16085P
| Artikelname: |
MTA1 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: |
MBL-CNA16085P |
| Hersteller Artikelnummer: |
CNA16085P |
| Alternativnummer: |
MBL-CNA16085P |
| Hersteller: |
MBL |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human, Mouse |
| Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 600-700 of human MTA1 (NP_004680.2). |
| Konjugation: |
Unconjugated |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
81kDa |
| NCBI: |
9112 |
| Puffer: |
PBS with 0.05% proclin300,50% glycerol |
| Quelle: |
Rabbit |
| Reinheit: |
Affinity purification |
| Formulierung: |
PBS with 0.05% proclin300,50% glycerol |
| Sequenz: |
LMPSRGLANHGQARHMGPSRNLLLNGKSYPTKVRLIRGGSLPPVKRRRMNWIDAPDDVFYMATEETRKIRKLLSSSETKRAARRPYKPIALRQSQALPPRP |
| Target-Kategorie: |
MTA1 |
| Application Verdünnung: |
WB: WB,1:1000 - 1:5000 |
