SLC28A2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16086T
Artikelname: SLC28A2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16086T
Hersteller Artikelnummer: CNA16086T
Alternativnummer: MBL-CNA16086T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 350-450 of human SLC28A2 (NP_004203.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 72kDa
NCBI: 9153
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: GAFIAFGVDASSLISASVMAAPCALASSKLAYPEVEESKFKSEEGVKLPRGKERNVLEAASNGAVDAIGLATNVAANLIAFLAVLAFINAALSWLGELVDI
Target-Kategorie: SLC28A2
Application Verdünnung: WB: WB,1:500 - 1:2000