ABI1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16092T
Artikelname: ABI1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16092T
Hersteller Artikelnummer: CNA16092T
Alternativnummer: MBL-CNA16092T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 180-230 of human ABI1 (NP_001012770).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 55kDa
NCBI: 10006
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: PMSGRGTLGRNTPYKTLEPVKPPTVPNDYMTSPARLGSQHSPGRTASLNQR
Target-Kategorie: ABI1
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200