TSFM Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16094T
Artikelname: TSFM Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16094T
Hersteller Artikelnummer: CNA16094T
Alternativnummer: MBL-CNA16094T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 245-346 of human TSFM (NP_001166167).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 35kDa
NCBI: 10102
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: PSLHKLVLGKYGALVICETSEQKTNLEDVGRRLGQHVVGMAPLSVGSLDDEPGGEAETKMLSQPYLLDPSITLGQYVQPQGVSVVDFVRFECGEGEEAAETE
Target-Kategorie: TSFM
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:100