DENND4A Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16095T
Artikelname: DENND4A Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16095T
Hersteller Artikelnummer: CNA16095T
Alternativnummer: MBL-CNA16095T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1500-1650 of human DENND4A (NP_005839.3).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 209kDa
NCBI: 10260
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: RPGRYFLKSSPSTENMHFPSSISSQTRQSCISTSASGLDTSALSVQGNFDLNSKSKLQENFCTRSIQIPANRSKTAMSKCPIFPMARSISTSGPLDKEDTGRQKLISTGSLPATLQGATDSLGLEWHLPSPDPVTVPYLSPLVVWKELESL
Target-Kategorie: DENND4A
Application Verdünnung: WB: WB,1:500 - 1:2000