FBXO21 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16107T
Artikelname: FBXO21 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16107T
Hersteller Artikelnummer: CNA16107T
Alternativnummer: MBL-CNA16107T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 440-621 of human FBXO21 (NP_055817.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 72kDa
NCBI: 23014
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: PEKVLDILQHIQTLDPGQHGAVGYLVQHTLEHIERKKEEVGVEVKLRSDEKHRDVCYSIGLIMKHKRYGYNCVIYGWDPTCMMGHEWIRNMNVHSLPHGHHQPFYNVLVEDGSCRYAAQENLEYNVEPQEISHPDVGRYFSEFTGTHYIPNAELEIRYPEDLEFVYETVQNIYSAKKENIDE
Target-Kategorie: FBXO21
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200