PDE11A Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16121T
Artikelname: PDE11A Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16121T
Hersteller Artikelnummer: CNA16121T
Alternativnummer: MBL-CNA16121T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 712-933 of human PDE11A (NP_058649.3).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 105kDa
NCBI: 50940
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: NNAFQAKSGSALAQLYGTSATLEHHHFNHAVMILQSEGHNIFANLSSKEYSDLMQLLKQSILATDLTLYFERRTEFFELVSKGEYDWNIKNHRDIFRSMLMTACDLGAVTKPWEISRQVAELVTSEFFEQGDRERLELKLTPSAIFDRNRKDELPRLQLEWIDSICMPLYQALVKVNVKLKPMLDSVATNRSKWEELHQKRLLASTASSSPASVMVAKEDRN
Target-Kategorie: PDE11A
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200