TMC5 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16144T
Artikelname: TMC5 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16144T
Hersteller Artikelnummer: CNA16144T
Alternativnummer: MBL-CNA16144T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 676-760 of human TMC5 (NP_079056.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 115kDa
NCBI: 79838
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: YWQITEGRKIMIRLLHEQIINEGKDKMFLIEKLIKLQDMEKKANPSSLVLERREVEQQGFLHLGEHDGSLDLRSRRSVQEGNPRA
Target-Kategorie: TMC5
Application Verdünnung: WB: WB,1:500 - 1:2000