BPIFB2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16148T
Artikelname: BPIFB2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16148T
Hersteller Artikelnummer: CNA16148T
Alternativnummer: MBL-CNA16148T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 40-340 of human BPIFB2 (NP_079503.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 49kDa
NCBI: 80341
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: IGKAPLQRALQVTVPHFLDWSGEALQPTRIRILNVHVPRLHLKFIAGFGVRLLAAANFTFKVFRAPEPLELTLPVELLADTRVTQSSIRTPVVSISACSLFSGHANEFDGSNSTSHALLVLVQKHIKAVLSNKLCLSISNLVQGVNVHLGTLIGLNPVGPESQIRYSMVSVPTVTSDYISLEVNAVLFLLGKPIILPTDATPFVLPRHVGTEGSMATVGLSQQLFDSALLLLQKAGALNLDITGQLRSDDNLLN
Target-Kategorie: BPIFB2
Application Verdünnung: WB: WB,1:500 - 1:2000