IDO1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1614P
Artikelname: IDO1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1614P
Hersteller Artikelnummer: CNA1614P
Alternativnummer: MBL-CNA1614P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-403 of human IDO1 (NP_002155.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 45kDa
NCBI: 3620
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: MAHAMENSWTISKEYHIDEEVGFALPNPQENLPDFYNDWMFIAKHLPDLIESGQLRERVEKLNMLSIDHLTDHKSQRLARLVLGCITMAYVWGKGHGDVRKVLPRNIAVPYCQLSKKLELPPILVYADCVLANWKKKDPNKPLTYENMDVLFSFRDGDCSKGFFLVSLLVEIAAASAIKVIPTVFKAMQMQERDTLLKALLEIASCLEKALQVFHQIHDHVNPKAFFSVLRIYLSGWKGNPQLSDGLVYEGFWE
Target-Kategorie: IDO1
Application Verdünnung: WB: WB,1:100 - 1:500|IF/ICC,1:50 - 1:200