HPS4 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16157T
Artikelname: HPS4 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16157T
Hersteller Artikelnummer: CNA16157T
Alternativnummer: MBL-CNA16157T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 387-708 of human HPS4 (NP_071364.4).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 77kDa
NCBI: 89781
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: FAFLHVPVPDGRAPYCKASLSASSSLEPTPPEDTAISSLRPPSAPEMLTQHGAQEQLEDHPGHSSQAPIPRADPLPRRTRRPLLLPRLDPGQRGNKLPTGEQGLDEDVDGVCESHAAPGLECSSGSANCQGAGPSADGISSRLTPAESCMGLVRMNLYTHCVKGLVLSLLAEEPLLGDSAAIEEVYHSSLASLNGLEVHLKETLPRDEAASTSSTYNFTHYDRIQSLLMANLPQVATPQDRRFLQAVSLMHSEF
Target-Kategorie: HPS4
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200