RNF185 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16158T
Artikelname: RNF185 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16158T
Hersteller Artikelnummer: CNA16158T
Alternativnummer: MBL-CNA16158T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human RNF185 (NP_689480.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 20kDa
NCBI: 91445
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MASKGPSASASPENSSAGGPSGSSNGAGESGGQDSTFECNICLDTAKDAVISLCGHLFCWPCLHQWLETRPNRQVCPVCKAGISRDKVIPLYGRGSTGQQDPREKTPPRPQGQRPEPENRGGFQGFGFGD
Target-Kategorie: RNF185
Application Verdünnung: WB: WB,1:500 - 1:2000