MAS1L Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16161T
Artikelname: MAS1L Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16161T
Hersteller Artikelnummer: CNA16161T
Alternativnummer: MBL-CNA16161T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human MAS1L (NP_443199.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 42kDa
NCBI: 116511
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MVWGKICWFSQRAGWTVFAESQISLSCSLCLHSGDQEAQNPNLVSQLCGVFLQNETNETIHMQMSMAVGQ
Target-Kategorie: MAS1L
Application Verdünnung: WB: WB,1:500 - 1:2000