GPR155 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16173T
Artikelname: GPR155 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16173T
Hersteller Artikelnummer: CNA16173T
Alternativnummer: MBL-CNA16173T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 721-870 of human GPR155 (NP_001028217.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 97kDa
NCBI: 151556
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: PFKRRLEFLWNNKDTAENRDSPVSEEIKMTCQQFIHYHRDLCIRNIVKERRCGAKTSAGTFCGCDLVSWLIEVGLASDRGEAVIYGDRLVQGGVIQHITNEYEFRDEYLFYRFLQKSPEQSPPAINANTLQQERYKEIEHSSPPSHSPKT
Target-Kategorie: GPR155
Application Verdünnung: WB: WB,1:500 - 1:2000