WBSCR27 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16176T
Artikelname: WBSCR27 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16176T
Hersteller Artikelnummer: CNA16176T
Alternativnummer: MBL-CNA16176T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-245 of human WBSCR27 (NP_689772.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 27kDa
NCBI: 155368
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MAQEEGGSLPEVRARVRAAHGIPDLAQKLHFYDRWAPDYDQDVATLLYRAPRLAVDCLTQALPGPPHSALILDVACGTGLVAAELRAPGFLQLHGVDGSPGMLEQAQAPGLYQRLSLCTLGQEPLPSPEGTFDAVLIVGALSDGQVPCNAIPELHVTKPGGLVCLTTRTNSSNLQYKEALEATLDRLEQAGMWEGLVAWPVDRLWTAGSWLPPSWRWYPASLPRMASSPALSTCTESGRRPRLRK
Target-Kategorie: METTL27
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200