SERPINA9 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16182T
Artikelname: SERPINA9 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16182T
Hersteller Artikelnummer: CNA16182T
Alternativnummer: MBL-CNA16182T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 110-210 of human SERPINA9 (NP_783866.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 47kDa
NCBI: 327657
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: TQILQGLGFNLTHTPESAIHQGFQHLVHSLTVPSKDLTLKMGSALFVKKELQLQANFLGNVKRLYEAEVFSTDFSNPSIAQARINSHVKKKTQGKVVDIIQ
Target-Kategorie: SERPINA9
Application Verdünnung: WB: WB,1:500 - 1:2000