ZNF677 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16183T
Artikelname: ZNF677 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16183T
Hersteller Artikelnummer: CNA16183T
Alternativnummer: MBL-CNA16183T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 50-200 of human ZNF677 (NP_872415.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 68kDa
NCBI: 342926
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: DNIPPEDDISVGFTSKGLSPKENNKEELYHLVILERKESHGINNFDLKEVWENMPKFDSLWDYDVKNYKGMPLTCNKNLTHRKDQQHNKSSIHFSLKQSVSIRDSAHQYFIHDKPFIRNLLKLKNNIRYAGNKYVKCFENKIGLSLQAQLA
Target-Kategorie: ZNF677
Application Verdünnung: WB: WB,1:500 - 1:2000