PKC mu Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16185T
Artikelname: PKC mu Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16185T
Hersteller Artikelnummer: CNA16185T
Alternativnummer: MBL-CNA16185T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 800-900 of human PKC mu (NP_002733.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 102kDa
NCBI: 5587
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: YPPNPWKEISHEAIDLINNLLQVKMRKRYSVDKTLSHPWLQDYQTWLDLRELECKIGERYITHESDDLRWEKYAGEQGLQYPTHLINPSASHSDTPETEET
Target-Kategorie: PRKD1
Application Verdünnung: WB: WB,1:500 - 1:2000