USP33 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16187T
Artikelname: USP33 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16187T
Hersteller Artikelnummer: CNA16187T
Alternativnummer: MBL-CNA16187T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 290-400 of human USP33 (NP_963920.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 107kDa
NCBI: 23032
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: QVMEVEEDPQTITTEETMEEDKSQSDVDFQSCESCSNSDRAENENGSRCFSEDNNETTMLIQDDENNSEMSKDWQKEKMCNKINKVNSEGEFDKDRDSISETVDLNNQETV
Target-Kategorie: USP33
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:100