SLC6A9 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
MBL-CNA16203P
| Artikelname: |
SLC6A9 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: |
MBL-CNA16203P |
| Hersteller Artikelnummer: |
CNA16203P |
| Alternativnummer: |
MBL-CNA16203P |
| Hersteller: |
MBL |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human, Mouse, Rat |
| Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human SLC6A9 (NP_964012.2). |
| Konjugation: |
Unconjugated |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
78kDa |
| NCBI: |
6536 |
| Puffer: |
PBS with 0.05% proclin300,50% glycerol |
| Quelle: |
Rabbit |
| Reinheit: |
Affinity purification |
| Formulierung: |
PBS with 0.05% proclin300,50% glycerol |
| Sequenz: |
MSGGDTRAAIARPRMAAAHGPVAPSSPEQVTLLPVQRSFFLPPFSGATPSTSLAESVLKVWHGAYNSGLLPQLMAQHSLAMAQNGAVPSEATKRDQNLKRGNWGNQIEFV |
| Target-Kategorie: |
SLC6A9 |
| Application Verdünnung: |
WB: WB,1:1000 - 1:5000 |
