CXCL6 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16207T
Artikelname: CXCL6 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16207T
Hersteller Artikelnummer: CNA16207T
Alternativnummer: MBL-CNA16207T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 38-114 of human CXCL6 (NP_002984.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 12kDa
NCBI: 6372
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: GPVSAVLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKN
Target-Kategorie: CXCL6
Application Verdünnung: WB: WB,1:500 - 1:2000