PTCD1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16219T
Artikelname: PTCD1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16219T
Hersteller Artikelnummer: CNA16219T
Alternativnummer: MBL-CNA16219T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 435-537 of human PTCD1 (NP_056360.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 79kDa
NCBI: 26024
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: PVELEVNLLTPGAVPPTVVSFGTVTTPADRLALIGGLEGFLSKMAEHRQQPDIRTLTLLAEVVESGSPAESLLLALLDEHQVEADLTFFNTLVRKKSKLGDLE
Target-Kategorie: PTCD1
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200