G6PC3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16234T
Artikelname: G6PC3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16234T
Hersteller Artikelnummer: CNA16234T
Alternativnummer: MBL-CNA16234T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human G6PC3 (NP_612396.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 39kDa
NCBI: 92579
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: SRRVGIAVLWISLITEWLNLIFKWFLFGDRPFWWVHESGYYSQAPAQVHQFPSSCETGPGSPSGHCMITGAALWPIMTALSSQVATRARSRWVRVMPSLAY
Target-Kategorie: G6PC3
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200