[KO Validated] KMT5C Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16235P
Artikelname: [KO Validated] KMT5C Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16235P
Hersteller Artikelnummer: CNA16235P
Alternativnummer: MBL-CNA16235P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human KMT5C (NP_116090.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 52kDa
NCBI: 84787
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: FLPESGFTILPCTRYSMETNGAKIVSTRAWKKNEKLELLVGCIAELREADEGLLRAGENDFSIMYSTRKRSAQLWLGPAAFINHDCKPNCKFVPADGNAAC
Target-Kategorie: KMT5C
Application Verdünnung: WB: WB,1:500 - 1:1000