NTN1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16236P
Artikelname: NTN1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16236P
Hersteller Artikelnummer: CNA16236P
Alternativnummer: MBL-CNA16236P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 500-600 of human NTN1 (NP_004813.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 68kDa
NCBI: 9423
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: HILKADKAGDWWKFTVNIISVYKQGTSRIRRGDQSLWIRSRDIACKCPKIKPLKKYLLLGNAEDSPDQSGIVADKSSLVIQWRDTWARRLRKFQQREKKGK
Target-Kategorie: NTN1
Application Verdünnung: WB: WB,1:500 - 1:1000