SDHD Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16240T
Artikelname: SDHD Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16240T
Hersteller Artikelnummer: CNA16240T
Alternativnummer: MBL-CNA16240T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human SDHD (NP_002993.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 17kDa
NCBI: 6392
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: HLSPSHHSGSKAASLHWTSERVVSVLLLGLLPAAYLNPCSAMDYSLAAALTLHGHWGLGQVVTDYVHGDALQKAAKAGLLALSALTFAGLCYFNYHDVGIC
Target-Kategorie: SDHD
Application Verdünnung: WB: WB,1:500 - 1:2000