SMN1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16246T
Artikelname: SMN1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16246T
Hersteller Artikelnummer: CNA16246T
Alternativnummer: MBL-CNA16246T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 11-169 of SMN1 (NP_000335.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 32kDa
NCBI: 6606
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: GVPEQEDSVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICEVANNIEQNAQENENESQVSTDE
Target-Kategorie: SMN1
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200