DDX6 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16270T
Artikelname: DDX6 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16270T
Hersteller Artikelnummer: CNA16270T
Alternativnummer: MBL-CNA16270T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 400 to the C-terminus of human DDX6 (NP_001244120.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 54kDa
NCBI: 1656
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: IQAVNVVINFDFPKLAETYLHRIGRSGRFGHLGLAINLITYDDRFNLKSIEEQLGTEIKPIPSNIDKSLYVAEYHSEPVEDEKP
Target-Kategorie: DDX6
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:100|IF/ICC,1:50 - 1:100