WASF3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16274T
Artikelname: WASF3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16274T
Hersteller Artikelnummer: CNA16274T
Alternativnummer: MBL-CNA16274T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human WASF3 (NP_001278894.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 55kDa
NCBI: 10810
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: RTRKEEWERRKMGIEFMSDAKKLEQAGSAKEDRVPSGSHASDVTDYSYPATPNHSLHPQPVTPSYAAGDVPPHGPASQAAEHEYRPPSASARHMALNRPQQ
Target-Kategorie: WASF3
Application Verdünnung: WB: WB,1:500 - 1:2000