OPN4 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16289T
Artikelname: OPN4 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16289T
Hersteller Artikelnummer: CNA16289T
Alternativnummer: MBL-CNA16289T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 365-489 of human OPN4 (NP_001025186.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 53kDa
NCBI: 94233
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: HPKYRVAIAQHLPCLGVLLGVSRRHSRPYPSYRSTHRSTLTSHTSNLSWISIRRRQESLGSESEVGWTHMEAAAVWGAAQQANGRSLYGQGLEDLEAKAPPRPQGHEAETPGKTKGLIPSQDPRM
Target-Kategorie: OPN4
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200