BDNF Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16299T
Artikelname: BDNF Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16299T
Hersteller Artikelnummer: CNA16299T
Alternativnummer: MBL-CNA16299T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 148-247 of human BDNF (NP_001700.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 28kDa
NCBI: 627
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: VTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR
Target-Kategorie: BDNF
Application Verdünnung: WB: WB,1:500 - 1:1000