RPS6KA2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16305T
Artikelname: RPS6KA2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16305T
Hersteller Artikelnummer: CNA16305T
Alternativnummer: MBL-CNA16305T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 632-733 of human RPS6KA2 (NP_066958.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 83kDa
NCBI: 6196
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: ALSGGNWDSISDAAKDVVSKMLHVDPHQRLTAMQVLKHPWVVNREYLSPNQLSRQDVHLVKGAMAATYFALNRTPQAPRLEPVLSSNLAQRRGMKRLTSTRL
Target-Kategorie: RPS6KA2
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:100 - 1:200|IF/ICC,1:50 - 1:200