USP9X Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16307T
Artikelname: USP9X Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16307T
Hersteller Artikelnummer: CNA16307T
Alternativnummer: MBL-CNA16307T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human USP9X (NP_001034679.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 290kDa
NCBI: 8239
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MTATTRGSPVGGNDNQGQAPDGQSQPPLQQNQTSSPDSSNENSPATPPDEQGQGDAPPQLEDEEPAFPHTDLAKLDDMINRPRWVVPVLPKGELEVLLEA
Target-Kategorie: USP9X
Application Verdünnung: WB: WB,1:500 - 1:2000