Raptor Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16309P
Artikelname: Raptor Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16309P
Hersteller Artikelnummer: CNA16309P
Alternativnummer: MBL-CNA16309P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 888-1013 of human RPTOR (NP_065812.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 149kDa
NCBI: 57521
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: LTNDVAKQPVSRDLPSGRPGTTGPAGAQYTPHSHQFPRTRKMFDKGPEQTADDADDAAGHKSFISATVQTGFCDWSARYFAQPVMKIPEEHDLESQIRKEREWRFLRNSRVRRQAQQVIQKGITRL
Target-Kategorie: RPTOR
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200