RANKL Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16326S
Artikelname: RANKL Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16326S
Hersteller Artikelnummer: CNA16326S
Alternativnummer: MBL-CNA16326S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 78-317 of human RANKL (NP_003692.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 35kDa
NCBI: 8600
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: RISEDGTHCIYRILRLHENADFQDTTLESQDTKLIPDSCRRIKQAFQGAVQKELQHIVGSQHIRAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID
Target-Kategorie: TNFSF11
Application Verdünnung: WB: WB,1:500 - 1:1000