ATP6V0C Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16350P
Artikelname: ATP6V0C Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16350P
Hersteller Artikelnummer: CNA16350P
Alternativnummer: MBL-CNA16350P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ATP6V0C (NP_001185498.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 16kDa
NCBI: 527
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: MSESKSGPEYASFFAVMGASAAMVFSALGAAYGTAKSGTGIAAMSVMRPEQIMKSIIPVVMAGIIAIYGLVVAVLIANSLNDDISLYKSFLQLGAGLSVG
Target-Kategorie: ATP6V0C
Application Verdünnung: WB: WB,1:100 - 1:500|IF/ICC,1:50 - 1:200