CMKLR1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16358T
Artikelname: CMKLR1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16358T
Hersteller Artikelnummer: CNA16358T
Alternativnummer: MBL-CNA16358T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 250-350 of human CMKLR1 (NP_001135815.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 42kDa
NCBI: 1240
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: NRLAKTKKPFKIIVTIIITFFLCWCPYHTLNLLELHHTAMPGSVFSLGLPLATALAIANSCMNPILYVFMGQDFKKFKVALFSRLVNALSEDTGHSSYPSH
Target-Kategorie: CMKLR1
Application Verdünnung: WB: WB,1:500 - 1:1000