ECM1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16368T
Artikelname: ECM1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16368T
Hersteller Artikelnummer: CNA16368T
Alternativnummer: MBL-CNA16368T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 280-405 of human ECM1 (NP_004416.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 61kDa
NCBI: 1893
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: QLRACPSHQPDISSGLELPFPPGVPTLDNIKNICHLRRFRSVPRNLPATDPLQRELLALIQLEREFQRCCRQGNNHTCTWKAWEDTLDKYCDREYAVKTHHHLCCRHPPSPTRDECFARRAPYPNY
Target-Kategorie: ECM1
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200