NOX2/gp91phox Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1636S
Artikelname: NOX2/gp91phox Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1636S
Hersteller Artikelnummer: CNA1636S
Alternativnummer: MBL-CNA1636S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human NOX2/gp91phox (NP_000388.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 65kDa
NCBI: 1536
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: FHKMVAWMIALHSAIHTIAHLFNVEWCVNARVNNSDPYSVALSELGDRQNESYLNFARKRIKNPEGGLYLAVTLLAGITGVVITLCLILIITSSTKTIRRS
Target-Kategorie: CYBB
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200