GANC Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16377T
Artikelname: GANC Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16377T
Hersteller Artikelnummer: CNA16377T
Alternativnummer: MBL-CNA16377T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human GANC (NP_937784.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 104kDa
NCBI: 2595
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: DVLTSKPSTVRLISCSGDTGSLILADGKGDLKCHITANPFKVDLVSEEEVVISINSLGQLYFEHLQILHKQRAAKENEEETSVDTSQENQEDLGLWEEKFG
Target-Kategorie: GANC
Application Verdünnung: WB: WB,1:500 - 1:2000