IRF5 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16388T
Artikelname: IRF5 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16388T
Hersteller Artikelnummer: CNA16388T
Alternativnummer: MBL-CNA16388T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human IRF5 (NP_001092097.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 56kDa
NCBI: 3663
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MNQSIPVAPTPPRRVRLKPWLVAQVNSCQYPGLQWVNGEKKLFCIPWRHATRHGPSQDGDNTIFKAWAKETGKYTEGVDEADPAKWKANLRCALNKSRDFRLIYDGPRDMPPQPYKIYEVCSNGPAPTDSQPPEDYSFGAGEEEEEEEELQRMLPSLSLTEDVKWPPTLQPPTLRPPTLQPPTLQPPVVLGPPAPDPSPL
Target-Kategorie: IRF5
Application Verdünnung: WB: WB,1:500 - 1:2000