KAL1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16389T
Artikelname: KAL1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16389T
Hersteller Artikelnummer: CNA16389T
Alternativnummer: MBL-CNA16389T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human KAL1 (NP_000207.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 76kDa
NCBI: 3730
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: LEVKWSSKFNISIEPVIYVVQRRWNYGIHPSEDDATHWQTVAQTTDERVQLTDIRPSRWYQFRVAAVNVHGTRGFTAPSKHFRSSKDPSAPPAPANLRLAN
Target-Kategorie: ANOS1
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200