KIF2A Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16392T
Artikelname: KIF2A Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16392T
Hersteller Artikelnummer: CNA16392T
Alternativnummer: MBL-CNA16392T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 30-220 of human KIF2A (NP_004511.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 80kDa
NCBI: 3796
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: TSLNEDNESVTVEWIENGDTKGKEIDLESIFSLNPDLVPDEEIEPSPETPPPPASSAKVNKIVKNRRTVASIKNDPPSRDNRVVGSARARPSQFPEQSSSAQQNGSVSDISPVQAAKKEFGPPSRRKSNCVKEVEKLQEKREKRRLQQQELREKRAQDVDATNPNYEIMCMIRDFRGSLDYRPLTTADPID
Target-Kategorie: KIF2A
Application Verdünnung: WB: WB,1:500 - 1:1000