Cytokeratin 13 (KRT13) Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA16393S
Artikelname: Cytokeratin 13 (KRT13) Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA16393S
Hersteller Artikelnummer: CNA16393S
Alternativnummer: MBL-CNA16393S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 269-458 of human Cytokeratin 13 (Cytokeratin 13 (KRT13)) (NP_705694.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 50kDa
NCBI: 3860
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: DLTRVLAEMREQYEAMAERNRRDAEEWFHAKSAELNKEVSTNTAMIQTSKTEITELRRTLQGLEIELQSQLSMKAGLENTVAETECRYALQLQQIQGLISSIEAQLSELRSEMECQNQEYKMLLDIKTRLEQEIATYRSLLEGQDAKMIGFPSSAGSVSPRSTSVTTTSSASVTTTSNASGRRTSDVRRP
Target-Kategorie: KRT13
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:100|IF/ICC,1:50 - 1:100